DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and morn3

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_002937740.1 Gene:morn3 / 100489796 XenbaseID:XB-GENE-961553 Length:238 Species:Xenopus tropicalis


Alignment Length:229 Identity:79/229 - (34%)
Similarity:109/229 - (47%) Gaps:36/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWVMNKRQGVG 82
            :|.|.|.|...|..|:|.||.|...|.|.          |..||   .:.||||||...||.|.|
 Frog    24 AGLRHTIYSINGDEYTGEWLNNLRHGKGT----------FMWKK---SKSIYEGDWKCGKRSGFG 75

  Fly    83 --SMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAGE 145
              |:......|...:|||.|.:|.|.|.|..|||....|.|:|...:|.|.|..::.:.:||.||
 Frog    76 TYSVQDSNTGEYVKVYSGYWDNDKKHGYGTHFYSANEYYEGEWKCGKRCGWGRMYFANRDIYEGE 140

  Fly   146 WETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWENDNLKTSVVQDEPKIR 210
            |..|...|.|::..||.|||||.:..|.|:|.|.||::..||:.:|:|         ::|.||  
 Frog   141 WSEDKHSGQGMLCLANENRYEGSWKDGKKDGPGKFYYLDKGQLYEGVW---------IEDIPK-- 194

  Fly   211 CNAVI----------TSYPIPRNYLKYPNEIMRD 234
            |..:|          |.||:|...:..|..::::
 Frog   195 CGTMIDFGRTEAPYPTKYPLPEVKVADPEGVLKE 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 55/136 (40%)
morn3XP_002937740.1 PLN03185 34..>188 CDD:215619 64/166 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H42069
Inparanoid 1 1.050 127 1.000 Inparanoid score I4537
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48870
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.