DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and rsph1

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_031753300.1 Gene:rsph1 / 100489385 XenbaseID:XB-GENE-5945700 Length:300 Species:Xenopus tropicalis


Alignment Length:189 Identity:55/189 - (29%)
Similarity:84/189 - (44%) Gaps:34/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQ------LIYEGDWVMNKRQGVGSML 85
            |.|.:|.|                    ||..||:|.:|.      ..|.|::..||:.|.|:.:
 Frog    39 PNGDTYEG--------------------QYEGGKRHGQGTYRFKNGARYIGEYQQNKKHGAGTFM 83

  Fly    86 RKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYND-GNIYAGEWETD 149
            ...|::    |.|.|.||.:.|:|..:|.:|..|.|.|:.::|||.|:..|.: |:.|.|.|...
 Frog    84 YPDGSK----YEGDWVDDQRQGQGVYYYPNGDTYSGDWLSHQRHGQGVYTYAETGSKYVGTWVNG 144

  Fly   150 FRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWE-NDNLKTSVVQDEP 207
            .:.|.|.:.:.| :||:|.|......|.|. |....|..|.|.:| .:..|....::||
 Frog   145 KQEGSGELVHLN-HRYQGKFVGNSLLGPGK-YIFDIGCEQHGAYEQTEQEKDEDEEEEP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 45/141 (32%)
rsph1XP_031753300.1 PLN03185 20..>150 CDD:215619 39/134 (29%)
gliding_GltJ <222..>284 CDD:411345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.