DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and morn1

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_002936606.3 Gene:morn1 / 100487673 XenbaseID:XB-GENE-6035525 Length:501 Species:Xenopus tropicalis


Alignment Length:156 Identity:47/156 - (30%)
Similarity:78/156 - (50%) Gaps:18/156 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SGRRATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWVMNKRQGVG 82
            :|....::...|..|||.:...:..|.||       .||..|.:       |||::|...::|.|
 Frog    71 TGNGLRYWSSSGNKYSGEFQTGEIHGHGV-------MQYKDGGR-------YEGEFVFGIKEGHG 121

  Fly    83 SMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAGEWE 147
            .::.|.|.    .|||.::::.|.|.|:..:.:|..|.|.||.::|.|.|:....||:||.|:|.
 Frog   122 LLMDKEGQ----TYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWR 182

  Fly   148 TDFRHGLGVMFYANGNRYEGHFARGY 173
            .|..:|.|:|.:.:|..|:|.:..|:
 Frog   183 NDVFNGQGIMIHCSGVIYDGLWINGH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 37/115 (32%)
morn1XP_002936606.3 PLN03185 10..>191 CDD:215619 41/137 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1309439at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.