DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30429 and als2b

DIOPT Version :9

Sequence 1:NP_726512.1 Gene:CG30429 / 246609 FlyBaseID:FBgn0050429 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_009300450.1 Gene:als2b / 100318899 ZFINID:ZDB-GENE-080929-1 Length:1706 Species:Danio rerio


Alignment Length:218 Identity:60/218 - (27%)
Similarity:91/218 - (41%) Gaps:30/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SGR---RATFYYPGGGSYSGYWLCNKHQGWG---VKKTAKRTCQYFY-----GKKHPEGQL---- 67
            ||:   |....:|.|..|:|.:......|:|   |......:|.::.     ||.|..|..    
Zfish  1110 SGKPHGRGVVKWPDGRMYTGTFKNGFEDGFGDYVVSNKTLNSCDHYQGQWKDGKMHGFGTFRYAS 1174

  Fly    68 --IYEGDWVMNKRQGVGSMLR--KRGTEVQLIYSGRWYDDMKCGEGKQFYSD---GCVYFGKWIK 125
              :|||.:..|.|.|.| |||  |..:....::.|:|..|.|.|.|  .:.|   |..|.|.|:.
Zfish  1175 GEVYEGSFQDNMRHGHG-MLRSGKLNSTSPSVFIGQWQYDKKSGYG--VFDDITRGEKYMGMWLD 1236

  Fly   126 NRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYK-NGEGVFYHMHTGQIQ 189
            ::|.|.|:.....|..|.|.:..:...|.||:...:...:||.|...:. ||:||....:...|:
Zfish  1237 DQRQGNGVVVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGEFLEDWTLNGKGVLTMPNGDYIE 1301

  Fly   190 K---GMWENDNLKTSVVQDEPKI 209
            .   |:| ...||.|....:|.:
Zfish  1302 GSFCGVW-GTGLKMSGSYYKPSL 1323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30429NP_726512.1 COG4642 59..194 CDD:226989 44/149 (30%)
als2bXP_009300450.1 RCC1_2 88..117 CDD:290274
RCC1 104..160 CDD:278826
RCC1 165..211 CDD:278826
RCC1 567..614 CDD:278826
RCC1 619..665 CDD:278826
PH_alsin 952..1065 CDD:241423
COG4642 1085..1290 CDD:226989 51/182 (28%)
MORN 1104..1124 CDD:280628 4/13 (31%)
MORN 1153..1173 CDD:197832 4/19 (21%)
VPS9 1603..1702 CDD:280383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.