DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and Cgas

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_038938458.1 Gene:Cgas / 682147 RGDID:1586939 Length:510 Species:Rattus norvegicus


Alignment Length:367 Identity:83/367 - (22%)
Similarity:139/367 - (37%) Gaps:119/367 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIAKPNEFDLVFKLKFP------YYKSIAVTR--DPKIP-GNVL--------LDMTRVLELLKD 49
            :||:.|||||::|||:.|      ||::.|..|  ..:|| ||.|        |..|:||     
  Rat   207 VKISAPNEFDVMFKLEVPRIELEEYYETGAFYRVKFKRIPRGNPLSHFLEGEVLSATKVL----- 266

  Fly    50 DPREDFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKYRTCGP 114
                  .:.||||:..:.:.::..|.                     ||         :.:...|
  Rat   267 ------SKFRELIKEEVKEIKDTDVT---------------------VE---------EEKPGSP 295

  Fly   115 AHTIYVYGDYEYSVDYVPAICLAAE---------------QNVLPTKQLECFKRANTSYWEAIPK 164
            |.|:.:....|.|||    |.||.|               |:.|.||.....:|   ..:..:||
  Rat   296 AVTLLIRNPEEISVD----IILALESKGSWPISTKGGLPIQDWLGTKVRTNLRR---EPFYLVPK 353

  Fly   165 PLKPLTETSMISFRSSFYAVEKILLQD--VHENC----------RNAIRFMK--------KFRDV 209
            ..|........::|.||...||.:|.:  :.:.|          :..::.||        :|:::
  Rat   354 NAKDGNRFQGETWRLSFSHTEKYILNNHGIGKTCCESSGAKCCRKECLKLMKYLLEQLKREFQEL 418

  Fly   210 KTNLGNCKSYYIKTLFLWKIIQEPESYWLNPLSFILADMFDD----LAENLRRGVITFFWDPELN 270
            .   ..| ||::||.......::|:....:|.:  |:..||.    ..|.||...:..::.|:.|
  Rat   419 D---AFC-SYHVKTAIFHMWTKDPQDSQWDPRN--LSTCFDKFLTFFLECLRTEKLDHYFIPKFN 477

  Fly   271 MIDALTRDQVWEMYLCVQRIPRDLRGAEISRNKWSFFVLREF 312
            :......|:..:.:|. ::|       |..||. .|.:..:|
  Rat   478 LFSQELIDKKSKEFLS-EKI-------EYERNN-GFPIFNKF 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 77/342 (23%)
CgasXP_038938458.1 PHA03247 <2..143 CDD:223021
Mab-21 203..498 CDD:397398 78/352 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D331478at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.