DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and cgasa

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_685111.1 Gene:cgasa / 557043 ZFINID:ZDB-GENE-090313-23 Length:592 Species:Danio rerio


Alignment Length:322 Identity:64/322 - (19%)
Similarity:119/322 - (36%) Gaps:87/322 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIAKPNEFDLVFKLKFPY-------------YKSIAVTRDPKIPGNVLLDMTRVLELLKDDPRE 53
            |||.:|:|||::  |..|.             :.|||:.|.|                 ...|.:
Zfish   280 LKICEPDEFDVM--LTVPVERVDIQNFDEAGAFYSIALKRHP-----------------NKHPLD 325

  Fly    54 DFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKYRTCGPAHTI 118
            .|     |.:.:.:.|..  ::...|..::....:|.: :.|::::      ..|...| ||.|:
Zfish   326 KF-----LNEDKTIQASE--MLSEFRDGVKKAVEKATD-LPYKIKI------QRKKPKC-PAVTL 375

  Fly   119 YV-YGDYEYSVDYVPAICLAAEQNVLPTKQLECFK------RANTSYWEAIPKPLKPLTE----- 171
            .| .|....|||:|  :.|...:...|....:.|:      |...|..:..|..|.|..|     
Zfish   376 EVTEGRKNISVDFV--LGLKVHRASWPELTKDGFRVEHWLGRKVKSTMKRQPFYLVPKYEGIGNA 438

  Fly   172 -----TSMISFRSSFYAVEKILLQD---------------VHENCRNAIRFM---KKFRDVKTN- 212
                 .:..|:|.||..:||.:|:.               ..:.|...::::   .|..:.|:| 
Zfish   439 EHDGVVARDSWRISFSHIEKEILKSHGHTKTCCEGREQKCCRKECLKLLKYLLQQLKNDESKSNK 503

  Fly   213 LGNCKSYYIKTLFLWKIIQE-PESYW-LNPLSFILADMFDDLAENLRRGVITFFWDPELNMI 272
            :.:..||:.||..|...... .:..| .:.|:.....:.:|..::|:...:..|:.|..|::
Zfish   504 MSSFCSYHAKTTLLQACASRGTDIEWAYSELANCFQQLLEDFVKHLKNHQLPNFFIPSHNLL 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 64/322 (20%)
cgasaXP_685111.1 Mab-21 276..581 CDD:281298 64/322 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D331478at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.