DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and itprip

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001017872.1 Gene:itprip / 550570 ZFINID:ZDB-GENE-050417-422 Length:539 Species:Danio rerio


Alignment Length:351 Identity:72/351 - (20%)
Similarity:125/351 - (35%) Gaps:109/351 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIAKPNEFDLV--FKLKFPYYKSIAVTRDP--KIP------GNVLL------------------- 38
            :::||...||:  |....|......:..||  :||      |.:.|                   
Zfish   188 RVSKPPTCDLIVPFSPPQPLRFQFELWCDPSTEIPLDLQGCGRIQLIKPGGNGTDCLCGSIDLGD 252

  Fly    39 DMTRVL------ELLKDDPREDFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRV 97
            ||..:|      |:|:||      .:.||:..|   ...:....::..|.|...|:|..:||::.
Zfish   253 DMLCLLHNRNECEVLEDD------ALPELLCAR---DTTYLSKGQIMRWFQISVSKAWGKISHKY 308

  Fly    98 ELVAGVVSHLKYRTCGPAHTIYVYGDYEYSVDYVPAICL------AAEQNVLPTKQLECFKRANT 156
            :.      .|.:|                ::|:..|:.:      ....|:.|..|.|     ||
Zfish   309 DF------ELAFR----------------NLDFPGALKIKFPSGKTVVLNLTPAVQFE-----NT 346

  Fly   157 SYWEAIPKPLKPLTETSMIS---FRSSFYAVEKILLQDV---------HENCRNAIRFMKKFRDV 209
            ..:.....|    ::||..|   ::.|....||.||:.:         |.:|...:.|:.|.:..
Zfish   347 DAYLISHFP----SDTSNSSDTHWQLSLSVYEKNLLKHLAKSLPTNSCHIHCLQIVAFLHKKQTT 407

  Fly   210 KTNLGNCKSYYIKTLFLWKIIQEPESYWLNP--LSFILADMFDDLAENLRRGVITFFWDPELNMI 272
            .|......:|:|||..|..::.:..:.| .|  |...|.|:...|.::|.          |..:.
Zfish   408 LTGRSAFCNYHIKTALLHLLLSKRPAMW-QPQNLDSRLRDLLSFLQQSLE----------EKKLY 461

  Fly   273 DALTRDQVWEMYLCVQRIPRDLRGAE 298
            .||..:....:.:.|   |:.:|.||
Zfish   462 HALVGNPRIPVEILV---PKIIRTAE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 68/340 (20%)
itpripNP_001017872.1 CDC37_N <25..61 CDD:296150
Mab-21 <349..462 CDD:281298 27/127 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.