DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and Itpripl1

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_006234989.1 Gene:Itpripl1 / 499885 RGDID:1564158 Length:599 Species:Rattus norvegicus


Alignment Length:351 Identity:66/351 - (18%)
Similarity:120/351 - (34%) Gaps:88/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LLDMTRVLELLKDDPR-EDFQRIRELIQ--GRLVDAQNF-------------FVVDRLRSWL--- 82
            |::..|||...:..|: ||...|....:  |.|.:.|.|             |:::.....|   
  Rat   242 LIEACRVLSRREAHPQLEDCLGIGAAFEKWGTLHETQKFDVLVPIVPPQGTMFILEMRDPTLGRR 306

  Fly    83 --------------QSLFSQALNRISYR--VELVAGVVSHLKYRTCGPAHTIYVYGDYEYSVDYV 131
                          :.|....|..:.:|  ..:::...|.:|...|..:| :.||...::..:.|
  Rat   307 CGCVKVDSECVCKNEKLLGDVLCLVHHRDHSAMLSKCTSSIKAALCTSSH-LDVYKTVQWFRNMV 370

  Fly   132 P-AICLAAEQN----VLPTKQLEC-------------------FKRANTSYWEAIPKPLKPLTET 172
            . |..|.|.:.    .||.....|                   .:|.:|..:.....|.:  .:.
  Rat   371 SNAWALVAHKYDFKLTLPPSTTTCKLRLDYRSGRSLSISLVLGVQREDTLVYLVSQAPER--EQF 433

  Fly   173 SMISFRSSFYAVEKILLQDV---------HENCRNAIRFMKKFRDVKTNLGN--CKSYYIKTLFL 226
            :.:.:..||.|.|.:.|:.|         |..|...|..::..:.:......  ..||:.||..:
  Rat   434 TSVDWPESFAACEHLFLKLVGRFAPDNTCHLKCLQIILSLQDHQTLPPGASRPILTSYHFKTALM 498

  Fly   227 WKIIQEPESYWLN-PLSFILADMFDDLAENLRRGVITFFWDPELNMIDALTRDQVWEMYLCVQRI 290
            ..:::.|.:.|.: .||..|.|:...|..:|::..:..|.....::  .||..           |
  Rat   499 HLLLRLPLTDWQHRMLSQRLQDLLWFLGRSLQQRSLHHFLIGNTHL--PLTIP-----------I 550

  Fly   291 PRDLRGAEISRNKWSFFVLREFSHKK 316
            |:..|.|| ..|.:...||...:|.:
  Rat   551 PKAFRNAE-PVNLFQHLVLNPVAHSQ 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 57/322 (18%)
Itpripl1XP_006234989.1 Mab-21 <339..566 CDD:281298 46/243 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.