DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and Itprip

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001001738.2 Gene:Itprip / 414801 MGIID:3042776 Length:555 Species:Mus musculus


Alignment Length:269 Identity:52/269 - (19%)
Similarity:97/269 - (36%) Gaps:62/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IQGRLVDAQNFFV-VDRLRSWLQSLFSQALNRIS--YRVELVAGVVS-----HLKYRTCGPAHTI 118
            ::|.|...::.:: |.::..|.|...::|.:||:  |..:|..|.:.     .:|:|        
Mouse   286 MEGLLCSRESSYLDVMQVMKWFQMALTRAWHRIAHKYEFDLAFGELDTPGSLKIKFR-------- 342

  Fly   119 YVYGDYEYSVDYVPAICLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKPL--TETSMISFRSSF 181
                    |...:|.|.         |..::|   .::..:..:..|.:|.  ...|...:..||
Mouse   343 --------SGKSMPFIL---------TPVIQC---NDSDLYFILQLPKEPCGGGPASSAHWLLSF 387

  Fly   182 YAVEKILLQ---------DVHENCRNAIRFMKKFRDVKTNLGNCKSYYIKTLFLWKIIQEPESYW 237
            ...|:..|:         ..|.:|.....|:...:...|.......|::||..|..::....|.|
Mouse   388 AVYEREFLRMTGKALPEGACHLSCLQIASFLLSKQTRLTGPSGLSDYHLKTALLHLLLSRQASDW 452

  Fly   238 -LNPLSFILADMFDDLAENLRRGVITFFWDPELNMIDALTRDQVWEMYLCVQRIPRDLRGAEISR 301
             .:.|...|.|:|..|..:|....:..|:.....:.:||             .:|..:|.|| ..
Mouse   453 KASKLDVRLQDLFCFLERSLLEKKLYHFFMGNHKVPEAL-------------GLPEVVRRAE-PL 503

  Fly   302 NKWSFFVLR 310
            |.:..|||:
Mouse   504 NLFRPFVLQ 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 44/246 (18%)
ItpripNP_001001738.2 Radial_spoke_3 <34..>67 CDD:399236
Mab-21 <377..485 CDD:397398 22/107 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.