DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and CG7194

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_648203.1 Gene:CG7194 / 38933 FlyBaseID:FBgn0035868 Length:346 Species:Drosophila melanogaster


Alignment Length:311 Identity:82/311 - (26%)
Similarity:135/311 - (43%) Gaps:67/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIAKPNEFDLVFKLKFPYYKSIAVTRDPKIPGNVLL--DMTRVLELLKDDPREDFQRIRELIQG 64
            :|:..|:||||..|||||:  .|..||..:  |.:.|  |:|.:      :|    |||..::  
  Fly    63 VKLNLPDEFDLHMKLKFPF--DIRPTRIDQ--GFIYLEADLTVI------NP----QRIHRIV-- 111

  Fly    65 RLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKY--RTCGPAHTIY-VYGDYEY 126
                         |:.||::.|.:.. |.:..:...:..|..|.|  ...|.||||. |.|....
  Fly   112 -------------LQDWLRNAFRKVF-RSNQTIATTSNRVYKLTYTLEGYGCAHTILAVCGSRSI 162

  Fly   127 SVDYVPAICLAAEQ---NVLPTKQLECFKRANTSYWEAIP----KPLKPLTETSMISFRSSFYAV 184
            |.|.|||...:..|   ::.|...    ..:|...|.|||    |..||         |::|...
  Fly   163 SFDLVPAFEFSGSQWPFDICPVPA----DVSNNWPWFAIPQQKKKSAKP---------RTTFMVC 214

  Fly   185 ----EKILLQDVHENCRNAIRFMKKFRDVKT-NLGNCKSYYIKTLFLWKIIQEPESYWLNPLSFI 244
                |:.:::. .:|.:|.:|.||..||... .|.:..||.:||:.|.::   ..:.|...|..:
  Fly   215 APHWEREIMKG-KDNLKNVLRLMKGLRDAHARKLPHLSSYMLKTVLLHRL---ESADWERDLGTL 275

  Fly   245 LADMFDDLAENLRRGVITFFWDPELNMIDALTRDQVWEMYLCVQRIPRDLR 295
            |.:|:..|.::||...:.||...:.|:.:.:.::   |:.:|::.....||
  Fly   276 LVEMWSHLVDHLRARRLEFFLAKDHNVFNRMNQN---EIKICLENASTLLR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 80/303 (26%)
CG7194NP_648203.1 Mab-21 59..317 CDD:281298 80/303 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D331478at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.