DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and CG12970

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_788360.2 Gene:CG12970 / 36744 FlyBaseID:FBgn0034047 Length:378 Species:Drosophila melanogaster


Alignment Length:350 Identity:140/350 - (40%)
Similarity:206/350 - (58%) Gaps:42/350 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIAKPNEFDLVFKLKFPYYKSIAVTRDPKIPGNVLLDMTRVLELL--KDDPREDFQRIRELIQG 64
            ||::.|:||||:..|.||....|.|..|...||||:||||:|:|::  ::..:..|.|::     
  Fly    64 LKVSIPDEFDLLIHLVFPENDKIIVKADASKPGNVILDMTKVMEIIGSQEHNKPVFDRLQ----- 123

  Fly    65 RLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKYRTCGPAHTIYVYGDYEYSVD 129
            ::|:.:...:.|:|.|:|:|:.:|.||::..::| |||.:|||:|:.|||||||:|.|..:||||
  Fly   124 KIVNNKKQLLEDKLNSFLESIMTQTLNKMGNQIE-VAGRISHLQYKKCGPAHTIFVKGSCKYSVD 187

  Fly   130 YVPAICLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKPLTETSMISFRSSFYAVEKILLQDVHE 194
            :||||.|:|.|.||..:|...|  ..|.||:|||||:|| .:|...||.||||..|:.||.. .:
  Fly   188 FVPAIRLSAAQVVLAPEQRIHF--GETLYWDAIPKPMKP-AKTDNTSFTSSFYEAERRLLYG-KQ 248

  Fly   195 NCRNAIRFMKKFRDVKTNLGNCKSYYIKTLFLWKIIQEPESYWLNPLSFILADMFDDLAENL--- 256
            ..:.|||.||:.|:|| |..|.|||:|||||||::||:..|||.|....|..:|...||::|   
  Fly   249 FLKPAIRLMKQNRNVK-NKANLKSYHIKTLFLWQVIQQDPSYWSNSPKDIFIEMLGKLADSLALT 312

  Fly   257 -RRGVITFFWDPELNMIDALTRDQVWEMYLCVQRIPRDLRGAEISRNKWSFFVLREFSHKKER-N 319
             ::|.:.|||||:|:|...||..|..::|                    :.|...|::.:|:. |
  Fly   313 PKKGKLPFFWDPKLDMFAQLTDSQRTDLY--------------------NHFRKCEYTFRKDNGN 357

  Fly   320 VNLKCSSRRKRNVIKGLKTTSICKL 344
            || .|:   :.||.......:..||
  Fly   358 VN-DCT---ENNVHSSFSKNTTYKL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 129/292 (44%)
CG12970NP_788360.2 Mab-21 60..342 CDD:281298 129/308 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DJWY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26964
OrthoDB 1 1.010 - - D331478at33208
OrthoFinder 1 1.000 - - FOG0019392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10656
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.