DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and CG15865

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_573143.1 Gene:CG15865 / 32641 FlyBaseID:FBgn0015336 Length:1084 Species:Drosophila melanogaster


Alignment Length:443 Identity:78/443 - (17%)
Similarity:135/443 - (30%) Gaps:191/443 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIAKPNEFDLVFKLKFPYYKSIAVTRDPKIPGNVLLDMTRVL--------------------EL 46
            |...:|.| :|.|...|.:.:::       :|||.:..:...|                    |.
  Fly   336 LNTPRPLE-ELRFDRDFNFQRNV-------LPGNCIRRLANCLPPWLEQTDDEESSSAASSSDED 392

  Fly    47 LKDDPREDFQR-----------IR----ELIQGRLVDAQNFFVVDRLRSWLQSLFSQAL-NRISY 95
            .||:...|.::           :|    |.:|...:.:|.|.:          .|.:.| :.::.
  Fly   393 EKDEANSDNRKYPPAGYETVEVLRQCHVEQLQQCYLSSQQFML----------YFGEVLRHHLAN 447

  Fly    96 RVELVAGVVSHLKYRTCGPAHTIYVYGDYEYSVDYVPAI--------CL---------------A 137
            ::.:....::...||.|.      ||...|   :.||||        |.               .
  Fly   448 QLGISQSQLAACSYRGCS------VYTARE---ELVPAIHVPNSWPDCAFEFWLRARPRLTNLHT 503

  Fly   138 AEQNVLPTKQLECFKRANTSYWEAIPKPLKPLTETSMISFRSSFYAVEKILLQDVHENCRNAIRF 202
            |||...||:|::  ||..:..:..:|....|                         :..||    
  Fly   504 AEQFQWPTEQMK--KRIRSMGFHVVPVGYAP-------------------------KRSRN---- 537

  Fly   203 MKKFRDVKTNLGNCKSYYIKTLFLWKII-----QEPESYWLNPLSF-------ILADMFDD---- 251
              .||:::                |:|:     |..|.:.|.|:..       :|...|.|    
  Fly   538 --PFRELE----------------WRIVFPQAEQFLERHCLTPMQLKVFQLMKLLVKTFVDESTT 584

  Fly   252 --------LAENLRRGVITFFWDPELNMIDALTRDQVWEMYLCVQRIPRDLRGAEISRNKWSFFV 308
                    |.|.||..:   ||..|.:..|       |         |.:..|..:.|...||..
  Fly   585 SCDQSPGALLEQLRAHM---FWQCEQHSND-------W---------PEEFLGERLVRFIRSFDA 630

  Fly   309 LREFSHKKERNVNLKCSSRRKRNVIKGLKTTSICKLRNARTNGTWTAGLWTRP 361
            .....|..:..:       .:||:.:.:...::.|||:.      .||:..:|
  Fly   631 CLAKKHLSDYFI-------ERRNLFEHIPEDTLMKLRSI------MAGIAEQP 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 64/369 (17%)
CG15865NP_573143.1 Mab-21 <472..656 CDD:281298 45/258 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10656
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.