DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and Itpripl2

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001028552.1 Gene:Itpripl2 / 319622 MGIID:2442416 Length:535 Species:Mus musculus


Alignment Length:351 Identity:70/351 - (19%)
Similarity:115/351 - (32%) Gaps:98/351 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIAKPNEFDLVFKLKFPYYKSIAVTRDPKIPGNVLLDMTRVLE-----LLKDDPRED-------F 55
            ||.:|:.||::..|:.|    ..|..:|:..|.. ..:|....     .||..|...       .
Mouse   167 KIRRPDSFDVLVPLRLP----PQVALEPRSLGTE-PSLTPAFRSCFVCALKAPPSPSGASTGQWH 226

  Fly    56 QRIRELIQGRLVDAQ--NFFVVDRLRSWLQSLFSQALNRISY------RVELVAGVVSHLKYRTC 112
            :..:...:|..||.|  .......:..|.|:...::|..:.|      ||.|..|.:........
Mouse   227 RDCKPFAEGFCVDVQGRRHLSATLVLRWFQAHLQRSLATVRYSLEGRCRVSLTPGSLEQPPTLHI 291

  Fly   113 GPAHTIYVYGDYEYSVDYVPAICLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKP---LTETSM 174
            .|..|.|.......:|..:||:.|                 .:..:..|.|.|..|   |:|...
Mouse   292 LPCRTDYGCCRLSMAVRLIPAVHL-----------------GDGVFLVAPPPPPSPSGALSELPG 339

  Fly   175 ISFRSSFYAV-----EKILLQDVHENC------RNAIRFMKKFRDV---------KTNLGN-CKS 218
            .....:.:.|     |:.||..:.|..      ...::.:|..||:         .|:.|. ..|
Mouse   340 GLRAEALWGVNTARQEQKLLGWLQERAPPGACYLKCLQLLKALRDLGARGLDPMAATHWGRILSS 404

  Fly   219 YYIKTLFLWKIIQE--PESYWLNPLSFILADMFDDLAENLRRGVITFFWDPELNMIDALTRDQVW 281
            |.:||..|..::.|  |...|...   .|::..:.|.:.||               |.|.|.:  
Mouse   405 YVLKTAVLEVLLNEGSPTPSWDEA---HLSECLEKLVKFLR---------------DCLLRRR-- 449

  Fly   282 EMYLC----------VQRIPRDLRGA 297
            :::.|          |..:|:.||.|
Mouse   450 DLFHCVLGPTGAAAEVGPLPKVLREA 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 66/341 (19%)
Itpripl2NP_001028552.1 Mab-21 163..496 CDD:281298 70/351 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.