DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and ITPRIPL1

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_848590.3 Gene:ITPRIPL1 / 150771 HGNCID:29371 Length:563 Species:Homo sapiens


Alignment Length:366 Identity:67/366 - (18%)
Similarity:128/366 - (34%) Gaps:90/366 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EFDLVFKLKFPYYKSIAV-TRDPKIP---GNVLLDMTRVL---ELLKD---------DPREDFQR 57
            :||::..:..|......: .|||.:.   |.||::...|.   :||.|         ||.....:
Human   242 KFDILVPIVPPQGTMFVLEMRDPALGRRCGCVLVESECVCKREKLLGDVLCLVHHHRDPSAVLGK 306

  Fly    58 IRELIQGRLVDAQNFFVVDRLRSWLQSLFSQA----LNRISYRVELVAGVVS---HLKYRTCGPA 115
            ....|:..|....:..|...:: |.:::...|    .::..:::.|.....|   .|.||: |..
Human   307 CSSSIKAALCTGFHLDVCKTVQ-WFRNMMGNAWALVAHKYDFKLSLPPSTTSCKLRLDYRS-GRF 369

  Fly   116 HTIYVYGDYEYSVDYVPAICLAAEQNVLPTKQLECFKRANTSYWEAIPKPLKPLTETSMISFRSS 180
            .:|::....:.....|..:..|.:|..|                             :.:.:..|
Human   370 LSIHLVLGVQREDTLVYLVSQAPDQEQL-----------------------------TSVDWPES 405

  Fly   181 FYAVEKILLQDV---------HENCRNAIRFMKKFRDVKTNLGN--CKSYYIKTLFLWKIIQEPE 234
            |.|.|.:.|:.|         |..|...|..:::.:.:......  ..||:.||..:..:::.|.
Human   406 FVACEHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKTALMHLLLRLPL 470

  Fly   235 SYWL-NPLSFILADMFDDLAENLRRGVITFFWDPELNMIDALTRDQVWEMYLCVQ-RIPRDLRGA 297
            :.|. |.||..|.|:...|...|::..:..|              .:...:|.:. .||:..|.|
Human   471 TDWAHNMLSQRLQDILWFLGRGLQQRSLHHF--------------LIGNNFLPLTIPIPKTFRNA 521

  Fly   298 EISRNKWSFFVLREFSHKKERNVNLKCSSRRKRNVIKGLKT 338
            | ..|.:...||...:|.:        :....:|::..:||
Human   522 E-PVNLFQHLVLNPKAHSQ--------AVEEFQNLLTQVKT 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 55/315 (17%)
ITPRIPL1NP_848590.3 Mab-21 <364..530 CDD:281298 38/210 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.