DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and LOC100536487

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_003200687.2 Gene:LOC100536487 / 100536487 -ID:- Length:457 Species:Danio rerio


Alignment Length:316 Identity:77/316 - (24%)
Similarity:124/316 - (39%) Gaps:78/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKIAKPNEFDLVFKLKFP--------YYKSIAVTRDPKIPGNVLLDMTRVLELLKDDPREDFQR 57
            |:||.||||||::.|:|.|        .||.:..|                ::|:| ..|::.|.
Zfish    82 MVKIHKPNEFDIMLKIKVPRIDFLELEEYKGLFYT----------------VKLMK-STRKEIQH 129

  Fly    58 IRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRV--ELVAGVVSHLKYRTCGPAHTIYV 120
            .. |..||.:.|..  |...:...::...|.......:.:  :||......|:|.:...|     
Zfish   130 FL-LEDGRTISATK--VKAEMHRLVRKFVSNHFQGKGWTICRKLVNSPAVTLEYTSKEKA----- 186

  Fly   121 YGDYEYSVDYVPAI--------CLAAEQNVLPTKQLECFKRANTSYWEAIPKPLK--PLTETSMI 175
              |...|||.||.:        ...|..||......:|.::..:.....|||..|  .|::.:..
Zfish   187 --DEVMSVDIVPTLEVPQGWPQAARAGPNVDQWLGKKCRRQFVSKAVYFIPKRPKGRNLSDDAKE 249

  Fly   176 SFRSSFYAVEKILLQDVHEN------------CRN-AIRFMKKF-----RDVKTNLGNCKSYYIK 222
            |:|.||..:||.::| .|.|            ||. .:|.:|..     :.....|....||:.|
Zfish   250 SWRISFSHIEKEIMQ-YHGNKKTCCETSSNRCCRKVCLRLLKCLIEGLKQQFPKELEPLCSYHGK 313

  Fly   223 TLFLWKIIQE--PESYWLNP----LSFI-LADMFDDLAENLRRGVITFFWDPELNM 271
            |.| :.::.:  .:|.| :|    :||: |...|:..|.|   |.:..|:..|.|:
Zfish   314 TAF-FHVLSDRVHDSLW-SPGQLSVSFMKLFGYFERCALN---GSLLHFFVREHNL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 77/316 (24%)
LOC100536487XP_003200687.2 ALP_like <53..>88 CDD:304875 3/5 (60%)
Mab-21 79..366 CDD:281298 77/316 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D331478at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.