DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30424 and cgas

DIOPT Version :9

Sequence 1:NP_001097455.1 Gene:CG30424 / 246606 FlyBaseID:FBgn0050424 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_002937200.3 Gene:cgas / 100488048 XenbaseID:XB-GENE-6466735 Length:592 Species:Xenopus tropicalis


Alignment Length:367 Identity:89/367 - (24%)
Similarity:136/367 - (37%) Gaps:120/367 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKIAKPNEFDLVFKLKFP--------------YYKSIAVTRDPKIPGNVLLDMTRVLELLKDDPR 52
            :||:||||||::  ||.|              :| ::.:.|:||.|      :|..:|..|...:
 Frog   297 VKISKPNEFDIM--LKIPCGRLRISESDASGSFY-TLTINRNPKHP------LTNYVENGKISGQ 352

  Fly    53 EDFQRIRELIQGRLVDAQNFFVVDRLRSWLQSLFSQALNRISYRVELVAGVVSHLKYRTCGPAHT 117
            :...|:||||:.:|                 |.....:|     ||         :.....||.|
 Frog   353 QMLDRLRELIKSKL-----------------SRLGTGIN-----VE---------RRNAASPAVT 386

  Fly   118 IYVYGDYEYSVDYVPAICLAAE-QNVLPTKQLECFK-------RANTSY-WEAIPKPLKPLTETS 173
            |.:   .|.|||.|    ||.| :...|:...|..|       :....| :|.:....|.|..|.
 Frog   387 IKI---GEISVDLV----LALEVEGSWPSSTSEGMKIETWLGAKVKRDYKFEPMYFVAKQLKNTE 444

  Fly   174 MISFRSSFYAVEKILLQDVHEN------------CR-NAIRFMKKFRDVKTNLGN------CKSY 219
            .|.:|.||..:||.:|:: |.|            || ..::.||...:...:.||      | ||
 Frog   445 EILWRISFSHIEKEILKN-HGNAKTCCETEGVKCCRKQCLKLMKYLLEQLKSKGNRNMTHFC-SY 507

  Fly   220 YIKTLFLWKIIQEPESYWLNPLSFILADMFD----DLAENLRRGVITFFWDPELNMIDALTRDQV 280
            :.||..|......|:.....|..  ||..||    |..:.|:...:..|:.|.||:...      
 Frog   508 HAKTALLHSCTLYPKDDDWRPKD--LAACFDRYIEDFMKCLKDARLPNFFIPSLNLFSE------ 564

  Fly   281 WEMYLCVQRIPRDLRGAEISRNKWSFFVLREFSHKKERNVNL 322
                   :.||:          |...::||:...:|:....|
 Frog   565 -------ELIPK----------KCLDYLLRKLDKQKKLQYTL 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30424NP_001097455.1 Mab-21 1..289 CDD:281298 82/332 (25%)
cgasXP_002937200.3 Mab-21 293..581 CDD:397398 87/357 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D331478at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.