DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30423 and VPS55

DIOPT Version :9

Sequence 1:NP_726490.3 Gene:CG30423 / 246605 FlyBaseID:FBgn0050423 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_012578.3 Gene:VPS55 / 853502 SGDID:S000003805 Length:140 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:41/137 - (29%)
Similarity:68/137 - (49%) Gaps:23/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLP--VFIARRTTPGNE------- 60
            |.:.:..|| .:|...:||:||:  ...:||.|.:|.::|:.:|  :|.|     ||:       
Yeast    11 KIISLSGFL-ALGFLLVILSCAL--FHNYYPLFDILIFLLAPIPNTIFNA-----GNKYHTSDFM 67

  Fly    61 ---TNPKSEFAHFLTAGMVLSAFALPIVLAHALVITWTASILTIISNIINYGTIF---WYAMRDD 119
               :|...:.|||||..:|.|..|||:|..|..:|...:.|:.:|..:|.|.:|.   |:..:|.
Yeast    68 SDSSNTGQDLAHFLTGMLVTSGIALPVVFYHCQLIGHLSCIMCMIGGLIIYSSIVIFKWFFKKDF 132

  Fly   120 EPYGSMF 126
            ....|:|
Yeast   133 NEDDSLF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30423NP_726490.3 Vps55 7..121 CDD:282046 38/128 (30%)
VPS55NP_012578.3 Vps55 12..131 CDD:398002 37/126 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346245
Domainoid 1 1.000 50 1.000 Domainoid score I2926
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I1807
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53954
OrthoFinder 1 1.000 - - FOG0001652
OrthoInspector 1 1.000 - - oto99592
orthoMCL 1 0.900 - - OOG6_103010
Panther 1 1.100 - - LDO PTHR12050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2334
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.