DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30423 and AT3G11530

DIOPT Version :9

Sequence 1:NP_726490.3 Gene:CG30423 / 246605 FlyBaseID:FBgn0050423 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_566391.1 Gene:AT3G11530 / 820326 AraportID:AT3G11530 Length:113 Species:Arabidopsis thaliana


Alignment Length:105 Identity:31/105 - (29%)
Similarity:49/105 - (46%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILACAVPTTKIFYPFFVLLFYVLSVLP-VFIARRTTP---GNETNPKSEFAHFLTAGMVLSAFAL 82
            |||||:...  ::|....|.||:..:| :|....:|.   ..:.....:.|.|||....:.:.|:
plant    10 ILACAIYGN--WWPMLSALMYVVVPMPCMFFGGGSTQFLISRDGGGWIDAAKFLTGASTVGSLAI 72

  Fly    83 PIVLAHALVITWTASILTIISNIINYGTI--FWYAMRDDE 120
            ||:|.||.:|...|.::...|..|...|:  |..|..||:
plant    73 PIILRHAQMIETGAMLIEFTSFFIFICTVMCFHRASLDDD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30423NP_726490.3 Vps55 7..121 CDD:282046 31/105 (30%)
AT3G11530NP_566391.1 Vps55 1..112 CDD:282046 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4636
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2675
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1642378at2759
OrthoFinder 1 1.000 - - FOG0001652
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103010
Panther 1 1.100 - - LDO PTHR12050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.