DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30423 and Leprotl1

DIOPT Version :9

Sequence 1:NP_726490.3 Gene:CG30423 / 246605 FlyBaseID:FBgn0050423 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_080885.1 Gene:Leprotl1 / 68192 MGIID:1915442 Length:131 Species:Mus musculus


Alignment Length:125 Identity:52/125 - (41%)
Similarity:72/125 - (57%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLKALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVFIARRTTPGNE--TNP 63
            ||.:|||...:|...||:.||:|.||:|....::|.|||.||:||.:|..||||.....:  :|.
Mouse     1 MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNA 65

  Fly    64 KSEFAHFLTAGMVLSAFALPIVLAHALVITWTASILTIISNIINYGTIFWYAM----RDD 119
            ..|.|.|||.|:|:|||.||:|.|.|.:|.|.|..|.:..|.:.:.||..:.:    .||
Mouse    66 CKELAIFLTTGIVVSAFGLPVVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDD 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30423NP_726490.3 Vps55 7..121 CDD:282046 48/119 (40%)
Leprotl1NP_080885.1 Vps55 7..124 CDD:398002 46/116 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849517
Domainoid 1 1.000 88 1.000 Domainoid score I7914
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I5044
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53954
OrthoDB 1 1.010 - - D1642378at2759
OrthoFinder 1 1.000 - - FOG0001652
OrthoInspector 1 1.000 - - otm43344
orthoMCL 1 0.900 - - OOG6_103010
Panther 1 1.100 - - LDO PTHR12050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2334
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.