DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30423 and Leprot

DIOPT Version :9

Sequence 1:NP_726490.3 Gene:CG30423 / 246605 FlyBaseID:FBgn0050423 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_064484.1 Gene:Leprot / 56766 RGDID:621034 Length:131 Species:Rattus norvegicus


Alignment Length:113 Identity:48/113 - (42%)
Similarity:71/113 - (62%) Gaps:2/113 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLKALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVFIARRTTPGNETNPKS 65
            ||.:|||...:|...||:|||:|.||:....:::|.|||:|||:|.:|.|||:|.|..::....:
  Rat     1 MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSDATSSA 65

  Fly    66 --EFAHFLTAGMVLSAFALPIVLAHALVITWTASILTIISNIINYGTI 111
              |.|:|.|.|:|:|||..|::||...||.|.|..|.:..|.:.:.||
  Rat    66 CRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTI 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30423NP_726490.3 Vps55 7..121 CDD:282046 44/107 (41%)
LeprotNP_064484.1 Vps55 7..124 CDD:398002 44/107 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353159
Domainoid 1 1.000 87 1.000 Domainoid score I7837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I4976
OMA 1 1.010 - - QHG53954
OrthoDB 1 1.010 - - D1642378at2759
OrthoFinder 1 1.000 - - FOG0001652
OrthoInspector 1 1.000 - - otm45416
orthoMCL 1 0.900 - - OOG6_103010
Panther 1 1.100 - - O PTHR12050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.