DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30423 and leprot

DIOPT Version :9

Sequence 1:NP_726490.3 Gene:CG30423 / 246605 FlyBaseID:FBgn0050423 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001017102.1 Gene:leprot / 549856 XenbaseID:XB-GENE-970688 Length:131 Species:Xenopus tropicalis


Alignment Length:127 Identity:54/127 - (42%)
Similarity:78/127 - (61%) Gaps:9/127 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLKALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVFIARRTTPGNETNPKS 65
            ||.:|||...:|...||:|||:|.||:.:.|:::|.|||:||.:|.:|.|||.|.:  ::|:..|
 Frog     1 MAGIKALVALSFSGAIGLTFLMLGCALESYKVYWPLFVLIFYAISPIPYFIAIRIS--DDTDAAS 63

  Fly    66 ----EFAHFLTAGMVLSAFALPIVLAHALVITWTASILTIISNIINYGTIFWYAM---RDDE 120
                |.|.|.|.|:|:|||.||||||...||.|.|..|.:..|.:.:.||..:.:   |.|:
 Frog    64 SACRELAFFFTTGIVVSAFGLPIVLARVGVILWGACGLVLAGNAVIFLTILGFFIVFGRSDD 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30423NP_726490.3 Vps55 7..121 CDD:282046 50/121 (41%)
leprotNP_001017102.1 Vps55 7..124 CDD:367832 49/118 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7974
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I4939
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1642378at2759
OrthoFinder 1 1.000 - - FOG0001652
OrthoInspector 1 1.000 - - otm48490
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.