DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30423 and LEPROT

DIOPT Version :9

Sequence 1:NP_726490.3 Gene:CG30423 / 246605 FlyBaseID:FBgn0050423 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001185610.1 Gene:LEPROT / 54741 HGNCID:29477 Length:140 Species:Homo sapiens


Alignment Length:108 Identity:43/108 - (39%)
Similarity:66/108 - (61%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVFIARRTTPGNETNPKS--EFA 68
            ||...:|...||:|||:|.||:....:::|.|||:|:.:|.:|.|||:|.|..::....:  |.|
Human    15 ALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELA 79

  Fly    69 HFLTAGMVLSAFALPIVLAHALVITWTASILTIISNIINYGTI 111
            :|.|.|:|:|||..|::||...||.|.|..|.:..|.:.:.||
Human    80 YFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTI 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30423NP_726490.3 Vps55 7..121 CDD:282046 42/107 (39%)
LEPROTNP_001185610.1 Vps55 16..133 CDD:367832 42/107 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159148
Domainoid 1 1.000 86 1.000 Domainoid score I8097
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I5082
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53954
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001652
OrthoInspector 1 1.000 - - otm41288
orthoMCL 1 0.900 - - OOG6_103010
Panther 1 1.100 - - O PTHR12050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2334
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.