DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30423 and zgc:92045

DIOPT Version :9

Sequence 1:NP_726490.3 Gene:CG30423 / 246605 FlyBaseID:FBgn0050423 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001002390.2 Gene:zgc:92045 / 436663 ZFINID:ZDB-GENE-040718-86 Length:131 Species:Danio rerio


Alignment Length:125 Identity:52/125 - (41%)
Similarity:73/125 - (58%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLKALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVFIARRTTPGNE--TNP 63
            ||.:|||...:|...||:.||:|.||:|....::|.|:|.||:|..||..|:||....::  :|.
Zfish     1 MAGIKALISLSFGGAIGLMFLMLGCALPVYNAYWPLFLLFFYILCPLPHCISRRVVEDSDSASNA 65

  Fly    64 KSEFAHFLTAGMVLSAFALPIVLAHALVITWTASILTIISNIINYGTIFWYAM----RDD 119
            ..|.|.|||.|:|:|||.|||:.|.|.||.|.|..|.:..||:.:.||..:.:    .||
Zfish    66 CKELAVFLTTGIVVSAFGLPIIFARAAVIAWGACALVLTGNIVIFATILGFFLVFGSNDD 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30423NP_726490.3 Vps55 7..121 CDD:282046 48/119 (40%)
zgc:92045NP_001002390.2 Vps55 7..124 CDD:282046 46/116 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595214
Domainoid 1 1.000 87 1.000 Domainoid score I7967
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I5065
OMA 1 1.010 - - QHG53954
OrthoDB 1 1.010 - - D1642378at2759
OrthoFinder 1 1.000 - - FOG0001652
OrthoInspector 1 1.000 - - otm25198
orthoMCL 1 0.900 - - OOG6_103010
Panther 1 1.100 - - LDO PTHR12050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.