DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30423 and vps55

DIOPT Version :9

Sequence 1:NP_726490.3 Gene:CG30423 / 246605 FlyBaseID:FBgn0050423 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_592907.2 Gene:vps55 / 2543247 PomBaseID:SPAC630.11 Length:128 Species:Schizosaccharomyces pombe


Alignment Length:120 Identity:27/120 - (22%)
Similarity:59/120 - (49%) Gaps:7/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLKALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVFIARRTTPGN-----E 60
            |:.|:.:...:.:..:|...:||:||:  .|.:||..:::.::|:.||..:.::.:..:     |
pombe     1 MSDLRKIIGLSSVLAVGFMLVILSCAL--FKNWYPLLIVIPFILAPLPNLLTKKYSTSHDFLQEE 63

  Fly    61 TNPKSEFAHFLTAGMVLSAFALPIVLAHALVITWTASILTIISNIINYGTIFWYA 115
            .....:|..|.....:.:.||||||..:..:|...|:.::.:...|.:..|..|:
pombe    64 DRNLLDFGRFTFGATICTGFALPIVFVNVGLIGTAAATMSCVGGSIIFLVITLYS 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30423NP_726490.3 Vps55 7..121 CDD:282046 25/114 (22%)
vps55NP_592907.2 Vps55 7..125 CDD:282046 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53954
OrthoFinder 1 1.000 - - FOG0001652
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103010
Panther 1 1.100 - - LDO PTHR12050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2334
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.