DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30423 and C30B5.2

DIOPT Version :9

Sequence 1:NP_726490.3 Gene:CG30423 / 246605 FlyBaseID:FBgn0050423 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_495238.2 Gene:C30B5.2 / 174028 WormBaseID:WBGene00016244 Length:132 Species:Caenorhabditis elegans


Alignment Length:123 Identity:56/123 - (45%)
Similarity:77/123 - (62%) Gaps:3/123 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLKALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVFIARRTTPG-NETNPK 64
            |..::|:...||...:|:|||:|.||:|....:.|.||:.|||||.:|:.||||.... ..||..
 Worm     1 MGGVRAVAALAFAGVVGLTFLVLGCALPRYGTWTPMFVITFYVLSPVPLLIARRFQEDMTGTNAC 65

  Fly    65 SEFAHFLTAGMVLSAFALPIVLAHALVITWTASILTIISNIINYGTI--FWYAMRDDE 120
            .|.|.|:|.|:|:||||||||||||..|..:|..|....::|.:|||  ::|..|||:
 Worm    66 IELALFITTGIVISAFALPIVLAHAGTIANSACFLVNTGSVIMFGTIIAYFYLHRDDD 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30423NP_726490.3 Vps55 7..121 CDD:282046 54/117 (46%)
C30B5.2NP_495238.2 Vps55 7..123 CDD:282046 53/115 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166727
Domainoid 1 1.000 91 1.000 Domainoid score I4905
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I3615
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53954
OrthoDB 1 1.010 - - D1642378at2759
OrthoFinder 1 1.000 - - FOG0001652
OrthoInspector 1 1.000 - - oto18663
orthoMCL 1 0.900 - - OOG6_103010
Panther 1 1.100 - - LDO PTHR12050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2334
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.