DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30423 and LOC100538044

DIOPT Version :9

Sequence 1:NP_726490.3 Gene:CG30423 / 246605 FlyBaseID:FBgn0050423 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_003197876.4 Gene:LOC100538044 / 100538044 -ID:- Length:107 Species:Danio rerio


Alignment Length:94 Identity:43/94 - (45%)
Similarity:62/94 - (65%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLKALFICAFLTCIGVTFLILACAVPTTKIFYPFFVLLFYVLSVLPVFIARRTTPGNE-TNPK 64
            ||.:|||...:|...:|:|||:|.||:.....::|.|||:||:||.:|..||||.....| :|..
Zfish     1 MAGIKALVSLSFSGALGLTFLLLGCALEQFGQYWPMFVLIFYILSPIPNLIARRHADDTESSNAC 65

  Fly    65 SEFAHFLTAGMVLSAFALPIVLAHALVIT 93
            .|.|:|||.|:|:||:.||:|||...|::
Zfish    66 RELAYFLTTGIVVSAYGLPVVLARKAVVS 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30423NP_726490.3 Vps55 7..121 CDD:282046 39/88 (44%)
LOC100538044XP_003197876.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7967
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I5065
OMA 1 1.010 - - QHG53954
OrthoDB 1 1.010 - - D1642378at2759
OrthoFinder 1 1.000 - - FOG0001652
OrthoInspector 1 1.000 - - otm25198
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.