DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and RSC4

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_012933.4 Gene:RSC4 / 853877 SGDID:S000001716 Length:625 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:60/258 - (23%)
Similarity:98/258 - (37%) Gaps:81/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LFSSTYKN------IAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDI 82
            |.:|:.||      ::..|.|.:|..  .|.:|:|||..||.||.|:..|..|.|....||..|:
Yeast   195 LGASSPKNLDDKVKLSEPFMELVDKD--ELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDM 257

  Fly    83 RLIFYNTYLYTNPDHLCYHMAKQL-----QIIFEEMYSQVQ------------------LYICSS 124
            .|:|.|.:::.:|..|.|..|..|     .:|.:|.:.::|                  .|:...
Yeast   258 LLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEFDKFEFENYLAIG 322

  Fly   125 GSKVRA-------------EEESSS----DESDSSSPEDEVNGSEVSPSIMGAPPSCTPTTECTP 172
            |....|             |.||:.    |::|......|..|:..:.|::              
Yeast   323 GGGPAAAGALAISALDNDIEPESNREDLIDQADYDFNHFEGLGNGYNRSLL-------------- 373

  Fly   173 TPDW-----------TPPATLETSEQQEPFTTEEDLDLHAKIQQLDGEVL----LHVIHFIQR 220
            |.|:           ..|.|:::..:.|..|| .|::   |...|:.|.|    .:||..:|:
Yeast   374 TEDYLLNPNNFKKLIAKPETVQSEVKNERSTT-SDIE---KTNSLESEHLKIPKYNVIKSMQK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 33/100 (33%)
RSC4NP_012933.4 COG5076 40..423 CDD:227408 57/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.