DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and RSC1

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_011570.1 Gene:RSC1 / 852947 SGDID:S000003288 Length:928 Species:Saccharomyces cerevisiae


Alignment Length:173 Identity:40/173 - (23%)
Similarity:60/173 - (34%) Gaps:56/173 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQI----- 108
            ||:.|:|.|:.|:|::.||..  |.|..||..|...|.:|...|...|.:.|..|..|:.     
Yeast    46 DYYIIIRNPISLNTLKKRLPH--YTSPQDFVNDFAQIPWNAMTYNAKDSVIYKYAILLESFIKGK 108

  Fly   109 ----------------------IFEEMYSQVQLYICSSGSKVRAEEESSSDESDSSSPEDEVNGS 151
                                  ||.|......|    |.:.:..:|   :||....:||.::..:
Yeast   109 IVHNIRKHYPEVTYPSLGRIPEIFAESMQPSDL----SSNPINTQE---NDEKAGLNPEMKMAFA 166

  Fly   152 EVSPSIMGAPP--------------------SCTPTTECTPTP 174
            ::..||....|                    |.||....:|||
Yeast   167 KLDSSITERKPTNQDYRMQQKNSPAFPTHSASITPQPLASPTP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 24/91 (26%)
RSC1NP_011570.1 Bromo_Rsc1_2_I 8..113 CDD:99952 21/68 (31%)
COG5076 115..463 CDD:227408 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.