DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and BDF2

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_010213.1 Gene:BDF2 / 851488 SGDID:S000002228 Length:638 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:41/163 - (25%)
Similarity:86/163 - (52%) Gaps:13/163 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKQETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRL 67
            :|.:::....:...|..|:|.|.|....:|.:.|.:|:||..|.|.:|.::|:.||||.|:.:.|
Yeast   312 SKPKSKTLQKKFRTCLKILKVLMSKKNSDINFPFLQPVDPIALNLPNYFDVVKNPMDLGTISNNL 376

  Fly    68 NTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIF-------EEMYSQVQLYICSSG 125
            ....|.:...|..|:.|:|||.:.:....:..:.|.|:|:.:|       :::.::::     :.
Yeast   377 MNWKYKTIDQFVDDLNLVFYNCFQFNPEGNEVHSMGKKLKELFNFHWLENQDILNEIE-----TD 436

  Fly   126 SKVRAEEESSSDESDSSSPEDEVNGSEV-SPSI 157
            |.:..:..|||..||....::::|.::: :|:|
Yeast   437 SDLEEDNYSSSYSSDDEYDDEDINENDITNPAI 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 31/107 (29%)
BDF2NP_010213.1 COG5076 55..378 CDD:227408 21/65 (32%)
Bromodomain <344..419 CDD:413371 24/74 (32%)
Lebercilin <472..>537 CDD:406132
BET 521..576 CDD:407211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345973
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 1 1.000 - - mtm9220
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.