DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and RSC2

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_013461.1 Gene:RSC2 / 851071 SGDID:S000004349 Length:889 Species:Saccharomyces cerevisiae


Alignment Length:260 Identity:46/260 - (17%)
Similarity:87/260 - (33%) Gaps:89/260 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMA---------- 103
            ||:.:::.|:..:|::.|:..  |..|..|..|:..|.:|...|...|...|..|          
Yeast    54 DYYAVIKNPVSFNTLKKRIPH--YTDAQQFMNDVVQIPWNAKTYNTRDSGIYKYALVLEKYLKDT 116

  Fly   104 -------KQLQIIFEEM--------YSQVQLYICSSGSKVRAEEESSSDESDSSSPEDEVNGSEV 153
                   |..|:::.::        |.:.|..:.....:| |...::..||.||     :|.:|.
Yeast   117 IYPNLKEKYPQLVYPDLGPLPDEPGYEEFQQKLREKAEEV-ARANAARAESSSS-----MNSTEA 175

  Fly   154 SPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQEPFT-TEEDLDLHAKIQQLDGEVLLHVIHF 217
            :..:.....|                    ...:.||.| |..|.|..|....:|..        
Yeast   176 ARRLRKTRTS--------------------VKRESEPGTDTNNDEDYEATDMDIDNP-------- 212

  Fly   218 IQRMEGAEYCNKELEF------DICKLKVHTKRGIRDYLASK----------GFTGKRVARTKPK 266
                       |:.:|      .:..:..:|::.:||..::.          |...::|:||:.|
Yeast   213 -----------KDADFPDLIRKPLININPYTRKPLRDNRSTTPSHSGTPQPLGPRHRQVSRTQVK 266

  Fly   267  266
            Yeast   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 17/89 (19%)
RSC2NP_013461.1 Bromo_Rsc1_2_I 17..121 CDD:99952 15/68 (22%)
COG5076 123..503 CDD:227408 31/189 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.