DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and GTE3

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_177458.1 Gene:GTE3 / 843646 AraportID:AT1G73150 Length:461 Species:Arabidopsis thaliana


Alignment Length:290 Identity:81/290 - (27%)
Similarity:123/290 - (42%) Gaps:57/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 INACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADF 78
            :.:|..::.:|..  :|: .|:|..|:|...|||||||.|::|||||.||:.||:...|.|..:|
plant   120 LKSCNNLLTKLMK--HKS-GWIFNTPVDVVTLGLHDYHNIIKEPMDLGTVKTRLSKSLYKSPLEF 181

  Fly    79 AKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMY----SQVQLYICSSGSKVRAEEESSSDES 139
            |:|:||.|.|..||....|..||||:.|..:|||.:    :|.:|.|         .::....:.
plant   182 AEDVRLTFNNAMLYNPVGHDVYHMAEILLNLFEEKWVPLETQYELLI---------RKQQPVRDI 237

  Fly   140 DSSSP-EDEVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQ---------------- 187
            |..:| ....:..|..|.     |:.||:....|.|......|||.:|.                
plant   238 DFHAPVSTNTHNVEALPL-----PAPTPSLSPPPPPKVVENRTLERAESMTNPVKPAVLPVVPEK 297

  Fly   188 -------QEPFTTEEDLDLHAKIQQLDGEVLLHVIHFI-QRMEGAEYCNKELEFDICKLKVHTK- 243
                   ....|.:|...|...:|.|..:.|..|:..| :|.......:.|:|.||..|.:.|. 
plant   298 LVEEASANRDLTFDEKRQLSEDLQDLPYDKLEAVVQIIKKRTPELSQQDDEIELDIDSLDLETLW 362

  Fly   244 ---RGIRDYLAS-------KGFTGKRVART 263
               |.:.:|..|       :|...:|.|.:
plant   363 ELFRFVTEYKESLSKKKEEQGLDSERDAES 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 44/99 (44%)
GTE3NP_177458.1 Bromo_plant1 120..217 CDD:99938 44/99 (44%)
BET 308..370 CDD:407211 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 1 1.000 - - mtm1066
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.