DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and GTE7

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_201366.3 Gene:GTE7 / 836689 AraportID:AT5G65630 Length:590 Species:Arabidopsis thaliana


Alignment Length:340 Identity:95/340 - (27%)
Similarity:130/340 - (38%) Gaps:92/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSPE--------INACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHR 66
            |.||        :|.|..|:.:|....:   ||||..|:|...|||||||::|::||||.||:..
plant   158 SDPESEKLLAGMLNTCSQILVKLMKHKW---AWVFNTPVDVVGLGLHDYHQVVKKPMDLGTVKLN 219

  Fly    67 LNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV-------QLYICSS 124
            |:.|.|:|..|||.|:||.|.|...|.......|.||.:|...|:.|::..       ||.:..|
plant   220 LDKGFYVSPIDFATDVRLTFDNAMTYNPKGQDVYFMADKLLDHFDGMFNPAFKKFEAQQLKLTGS 284

  Fly   125 GSKVR-------------------------AEEESSSDESDSSSPEDE------VNGSEV-SPSI 157
            .|:..                         .|:.|.:.:.||..|...      |..|.| |||.
plant   285 SSRPEPDFKPDFKQRQWNQNPPMVANPRKGTEQISIAKKLDSVKPPQPTLPPQLVEPSRVQSPSP 349

  Fly   158 MGAPPSCTPTTECTPTPDWTPPATLETSEQQEP-------------------------FTTEEDL 197
            ...||...|.   .|.|. .||..||...:..|                         .|.||..
plant   350 PPPPPVIQPE---LPQPQ-PPPPQLEIEVEAPPDVSEVSKGRKGKLPKPKAKDPNKRLMTMEEKS 410

  Fly   198 DLHAKIQQLDGEVLLHVIHFIQRMEG-AEYCNKELEFDICKLKVHT----KRGIRDY--LASK-- 253
            .|...:|.|..|.|..::..:::..| ......|:|.||..:...|    .|.:.:|  :|||  
plant   411 KLGMNLQDLPPEKLGQLLQILRKRNGHLAQDGDEIELDIEAVDNETLWELDRFVTNYKKMASKIK 475

  Fly   254 --GFTGKRVARTKPK 266
              ||.  |...|.|:
plant   476 RQGFI--RNVSTPPR 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 43/108 (40%)
GTE7NP_201366.3 Bromo_plant1 169..267 CDD:99938 42/100 (42%)
BET 404..466 CDD:374956 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1066
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.