DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and AT5G55040

DIOPT Version :10

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_200315.2 Gene:AT5G55040 / 835595 AraportID:AT5G55040 Length:916 Species:Arabidopsis thaliana


Alignment Length:54 Identity:13/54 - (24%)
Similarity:22/54 - (40%) Gaps:10/54 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 GTLIELKSDQFKDQLYDIAWPEMDLPEQGMF--KYVLKSAQQPKQLTCGRFAVI 365
            |.:..||.:..||        ..|||:...:  |.|:...:...:.|.|:..|:
plant   750 GKITVLKEESIKD--------TADLPKLTSWSTKNVIDYTKPDNRTTSGKITVM 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930
BET 190..252 CDD:435704
AT5G55040NP_200315.2 Bromodomain 187..283 CDD:99922
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.