DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and BET9

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001190308.1 Gene:BET9 / 831277 AraportID:AT5G14270 Length:689 Species:Arabidopsis thaliana


Alignment Length:236 Identity:73/236 - (30%)
Similarity:109/236 - (46%) Gaps:28/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKD 81
            |:.::|||.|..|   .|||..|:|...|.:.||..::..||||.||:::|.:|.|...::||.|
plant   141 CEALLKRLMSHQY---GWVFNTPVDVVKLNILDYFNVIEHPMDLGTVKNKLTSGTYSCPSEFAAD 202

  Fly    82 IRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLYICSSGSKVRAEEESSSDESDSSSPED 146
            :||.|.|...|..|.:..|.||..|:..||..:..::..:  ||:||.. |.|:.|    :..|.
plant   203 VRLTFSNAMTYNPPGNDVYVMADTLRKFFEVRWKTLEKKL--SGTKVHT-EPSNLD----AHKEK 260

  Fly   147 EVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQEPFTTEEDLDLHAKIQQLDGEVL 211
            .:    |.|..| |....|...:|....|   ||       :...|.|:.|.|...::.|. |..
plant   261 HI----VIPVPM-AKKRKTTAVDCENVVD---PA-------KRVMTDEDRLKLGKDLESLT-EFP 309

  Fly   212 LHVIHFIQRMEGAE--YCNKELEFDICKLKVHTKRGIRDYL 250
            ..:|:|::.....|  ..:.|:|.||..|..|....:||.|
plant   310 AQLINFLRDHNSNEGGIGDDEIEIDINDLSDHALFQLRDLL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 38/96 (40%)
BET9NP_001190308.1 Bromo_plant1 137..235 CDD:99938 38/96 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1066
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.