DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and BET10

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_566151.1 Gene:BET10 / 821083 AraportID:AT3G01770 Length:620 Species:Arabidopsis thaliana


Alignment Length:255 Identity:64/255 - (25%)
Similarity:107/255 - (41%) Gaps:40/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAKQE--TERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVR 64
            |.|.|  |..:...:..|:.::|||.|..:   .|:|..|:|...|.:.||..|::.||||.||:
plant   116 ATKPEPVTTSTMLRMKQCESLLKRLMSQQH---CWLFNTPVDVVKLNIPDYFTIIKHPMDLGTVK 177

  Fly    65 HRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLYICSSGSKVR 129
            .:|.:|.|.|.::|:.|:||.|.|...|...|:..|..|..|...||..:..::..  |||:|..
plant   178 SKLTSGTYSSPSEFSADVRLTFRNAMTYNPSDNNVYRFADTLSKFFEVRWKTIEKK--SSGTKSE 240

  Fly   130 AEEESSSDESDSSSPEDEVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQEP---- 190
            ....::....|.:.||......:::                          .::.:...||    
plant   241 PSNLATLAHKDIAIPEPVAKKRKMN--------------------------AVKRNSLLEPAKRV 279

  Fly   191 FTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGAE--YCNKELEFDICKLKVHTKRGIRD 248
            .|.|:.:.|...:..|. |..:.:|:|::.....|  ..:.|:|.||..|.......:||
plant   280 MTDEDRVKLGRDLGSLT-EFPVQIINFLRDHSSKEERSGDDEIEIDINDLSHDALFQLRD 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 36/100 (36%)
BET10NP_566151.1 Bromo_plant1 130..227 CDD:99938 36/99 (36%)
BET 279..342 CDD:407211 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.