DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and IMB1

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_181036.2 Gene:IMB1 / 818055 AraportID:AT2G34900 Length:386 Species:Arabidopsis thaliana


Alignment Length:283 Identity:68/283 - (24%)
Similarity:118/283 - (41%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAKQETER---SSPEINACKVIIKRLFSSTYKNI-----AWVFYEPLDPQLLGLHDYHEIVREPM 58
            |.|::::.   |||:       :.|.|::.::.|     ||.|.||:|.:.||||||::::.:||
plant    95 AGKEKSKGKHVSSPD-------LMRQFATMFRQIAQHKWAWPFLEPVDVKGLGLHDYYKVIEKPM 152

  Fly    59 DLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLYICS 123
            ||.|::.::.:..|.:..:...|:||:|.|...|.......|.||:.|...|||.:..:.     
plant   153 DLGTIKKKMESSEYSNVREIYADVRLVFKNAMRYNEEKEDVYVMAESLLEKFEEKWLLIM----- 212

  Fly   124 SGSKVRAEEESSSDESDSSSPEDEVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQ 188
              .|:..||:...||........::. .|.:.:.|....|           :......|:..:.:
plant   213 --PKLVEEEKKQVDEEAEKHANKQLT-MEAAQAEMARDLS-----------NELYEIDLQLEKLR 263

  Fly   189 E-------PFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRME-----GAEYCNKELEFDI------ 235
            |       ..:|:|...|.|.:.:|..|.|...:..:....     ||    .|:|.||      
plant   264 ESVVQRCRKLSTQEKKGLSAALGRLSPEDLSKALKMVSESNPSFPAGA----PEVELDIDVQTDV 324

  Fly   236 --CKLKVHTKRGIRDYLASKGFT 256
              .:|||..:..::....|.|.|
plant   325 TLWRLKVFVQEALKAANKSSGGT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 34/105 (32%)
IMB1NP_181036.2 Bromo_plant1 110..208 CDD:99938 34/97 (35%)
BET 272..335 CDD:407211 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 1 1.000 - - mtm1066
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.