DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and cecr2

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_005174419.1 Gene:cecr2 / 799918 ZFINID:ZDB-GENE-131121-533 Length:1502 Species:Danio rerio


Alignment Length:207 Identity:55/207 - (26%)
Similarity:87/207 - (42%) Gaps:25/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FSSTYKNI--------AWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKD 81
            :::.||.:        ||.|.||:|...  ..:||||::.||||||:..:||.|.||:..:|..|
Zfish   405 YTALYKVLEALKAHKDAWPFMEPVDESY--APNYHEIIQTPMDLSTIERKLNDGEYLAKDEFVAD 467

  Fly    82 IRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLYICSSGSKVRAEEESSSDESDSSSPED 146
            ::|:|.|...|...:.....||:.|    |..:::..|       |....|:..:||....|.||
Zfish   468 VKLMFGNCLEYNGEESEYTIMAESL----ERCFTRALL-------KHFPSEDGDTDEEFHVSSED 521

  Fly   147 EVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQEPFTTEEDLDLHAKIQQLDGEVL 211
            ..:..:........|.|....||.......:........:|::|.:|.:....|..    :|...
Zfish   522 RKDKKKNKNHKQSGPESLIRATEQVQKRKTSNSGKGNNQQQEKPKSTLQPPPPHYS----NGPPH 582

  Fly   212 LHVIHFIQRMEG 223
            .|.||..|:..|
Zfish   583 PHNIHPGQQQRG 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 33/96 (34%)
cecr2XP_005174419.1 DDT 23..63 CDD:280886
ARGLU 202..366 CDD:291991
Bromo_gcn5_like 403..503 CDD:99941 34/110 (31%)
Med15 675..>1110 CDD:255446
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.