Sequence 1: | NP_726307.1 | Gene: | tbrd-3 / 246604 | FlyBaseID: | FBgn0050417 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005174419.1 | Gene: | cecr2 / 799918 | ZFINID: | ZDB-GENE-131121-533 | Length: | 1502 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 55/207 - (26%) |
---|---|---|---|
Similarity: | 87/207 - (42%) | Gaps: | 25/207 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 FSSTYKNI--------AWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKD 81
Fly 82 IRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLYICSSGSKVRAEEESSSDESDSSSPED 146
Fly 147 EVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQEPFTTEEDLDLHAKIQQLDGEVL 211
Fly 212 LHVIHFIQRMEG 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tbrd-3 | NP_726307.1 | Bromo_Brdt_II_like | 13..114 | CDD:99930 | 33/96 (34%) |
cecr2 | XP_005174419.1 | DDT | 23..63 | CDD:280886 | |
ARGLU | 202..366 | CDD:291991 | |||
Bromo_gcn5_like | 403..503 | CDD:99941 | 34/110 (31%) | ||
Med15 | 675..>1110 | CDD:255446 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5076 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |