DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Brd3

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001107046.1 Gene:Brd3 / 67382 MGIID:1914632 Length:743 Species:Mus musculus


Alignment Length:346 Identity:89/346 - (25%)
Similarity:137/346 - (39%) Gaps:104/346 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSA 75
            |..:..|..|::.:.|..:...||.||:|:|.:.|.|||||:|::.|||||||:.::::..|..|
Mouse   308 SEHLRHCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDA 372

  Fly    76 ADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV-------------QLYICSSGSK 127
            ..||.||||:|.|.|.|..|||....||::||.:||..::::             ...|.|.|::
Mouse   373 QGFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPMEAPALPAPTAPIVSKGAE 437

  Fly   128 -VRAEEESSSDESDSSSPE---------------------------------------------- 145
             .|:.||||||...|.|.|                                              
Mouse   438 SSRSSEESSSDSGSSDSEEERATRLAELQEQTGCGAFQDQLLNVSSVQLKAVHEQLAALSQAPVN 502

  Fly   146 -------------------------------DEVNGSEVSPSIMGAPPSCTPTTECTPTPDWT-- 177
                                           :|...::.:|:...|.....||.:...|...:  
Mouse   503 KPKKKKEKKEKEKKKKDKDKDKEKEKHKAKSEEEKKAKAAPAAKQAQQKKAPTKKANSTTTASRQ 567

  Fly   178 -------PPATLETSEQQE--PFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGA--EYCNKEL 231
                   ..|:.::.|::|  |.:.:|...|...|.:|.||.|..|:|.||..|.:  :....|:
Mouse   568 LKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEI 632

  Fly   232 EFDICKLKVHTKRGIRDYLAS 252
            |.|...||..|.|.:..|:.|
Mouse   633 EIDFETLKPTTLRELERYVKS 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 44/100 (44%)
Brd3NP_001107046.1 Bromo_Brdt_I_like 33..139 CDD:99929
Bromo_Brdt_II_like 310..411 CDD:99930 44/100 (44%)
BET 589..653 CDD:374956 21/63 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.