DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and BRD2

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001186384.1 Gene:BRD2 / 6046 HGNCID:1103 Length:836 Species:Homo sapiens


Alignment Length:417 Identity:104/417 - (24%)
Similarity:148/417 - (35%) Gaps:166/417 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSA 75
            |.::..|..|:|.|.|..:...||.||:|:|...|||||||:|::.|||||||:.::....|..|
Human   347 SEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDA 411

  Fly    76 ADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV--------QLYICS--------- 123
            .:||.|:||:|.|.|.|..|||....||::||.:||..|:::        .|.:.:         
Human   412 QEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKS 476

  Fly   124 --------SGSKVRAEEESSSDESDSSSPEDEVNGSE---------------------------- 152
                    |.|:..:|||...||.|....|.|.:.||                            
Human   477 SSESSSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGP 541

  Fly   153 ----------------------------------------------------------VSPSIMG 159
                                                                      :.||..|
Human   542 ISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAALGPSGFG 606

  Fly   160 ---------------------APP-------SC--TPTTE-------CTPTPDWTPPA-----TL 182
                                 .||       ||  .|:::       .|.|   .|||     ..
Human   607 PSGGSGTKLQAGVQWRDLGLLQPPLLGFKRFSCLSLPSSQDYRLPKKATKT---APPALPTGYDS 668

  Fly   183 ETSEQQEPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGA--EYCNKELEFDICKLKVHTKRG 245
            |..|:..|.:.:|...|...|.:|.||.|..|:|.||..|.:  :...:|:|.|...||..|.|.
Human   669 EEEEESRPMSYDEKRQLSLDINKLPGEKLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRE 733

  Fly   246 IRDYLAS-------KGFTGKR-VARTK 264
            :..|:.|       |.:|.|: |.:||
Human   734 LERYVLSCLRKKPRKPYTIKKPVGKTK 760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 46/100 (46%)
BRD2NP_001186384.1 Bromo_Brdt_I_like 74..180 CDD:99929
Bromo_Brdt_II_like 349..450 CDD:99930 46/100 (46%)
GVQW 616..>651 CDD:290611 5/34 (15%)
BET 676..740 CDD:293640 21/63 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.