Sequence 1: | NP_726307.1 | Gene: | tbrd-3 / 246604 | FlyBaseID: | FBgn0050417 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001186384.1 | Gene: | BRD2 / 6046 | HGNCID: | 1103 | Length: | 836 | Species: | Homo sapiens |
Alignment Length: | 417 | Identity: | 104/417 - (24%) |
---|---|---|---|
Similarity: | 148/417 - (35%) | Gaps: | 166/417 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 SPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSA 75
Fly 76 ADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV--------QLYICS--------- 123
Fly 124 --------SGSKVRAEEESSSDESDSSSPEDEVNGSE---------------------------- 152
Fly 153 ----------------------------------------------------------VSPSIMG 159
Fly 160 ---------------------APP-------SC--TPTTE-------CTPTPDWTPPA-----TL 182
Fly 183 ETSEQQEPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGA--EYCNKELEFDICKLKVHTKRG 245
Fly 246 IRDYLAS-------KGFTGKR-VARTK 264 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tbrd-3 | NP_726307.1 | Bromo_Brdt_II_like | 13..114 | CDD:99930 | 46/100 (46%) |
BRD2 | NP_001186384.1 | Bromo_Brdt_I_like | 74..180 | CDD:99929 | |
Bromo_Brdt_II_like | 349..450 | CDD:99930 | 46/100 (46%) | ||
GVQW | 616..>651 | CDD:290611 | 5/34 (15%) | ||
BET | 676..740 | CDD:293640 | 21/63 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000322 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22880 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X197 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.010 |