DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Brd4

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001273559.1 Gene:Brd4 / 57261 MGIID:1888520 Length:1401 Species:Mus musculus


Alignment Length:330 Identity:94/330 - (28%)
Similarity:141/330 - (42%) Gaps:83/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNT 69
            :::.:.|.::..|..|:|.:|:..:...||.||:|:|.:.||||||.:|::.|||:||::.:|.:
Mouse   347 EKSSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLES 411

  Fly    70 GCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV------QLYICSS---- 124
            ..|..|.:|..|:||:|.|.|.|..|||....||::||.:||..::::      .:...||    
Mouse   412 REYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVTVSSPAVP 476

  Fly   125 -GSKVRAEEESSSDESDSSSPED------------------------------------------ 146
             .:||.|...||...|||||..|                                          
Mouse   477 PPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKK 541

  Fly   147 ----------------EVNGSEVSPSIMGAPPSCTPTTECT--------PTPDWT-PPATLETSE 186
                            ||..::.|.: ...||..|.....:        |.|..| ||.|.|:.|
Mouse   542 EKDKKEKKKEKHKKKEEVEENKKSKT-KELPPKKTKKNNSSNSNVSKKEPVPTKTKPPPTYESEE 605

  Fly   187 QQ--EPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRME-GAEYCN-KELEFDICKLKVHTKRGIR 247
            :.  :|.:.||...|...|.:|.||.|..|:|.||..| ..:..| .|:|.|...||..|.|.:.
Mouse   606 EDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELE 670

  Fly   248 DYLAS 252
            .|:.|
Mouse   671 RYVTS 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 42/100 (42%)
Brd4NP_001273559.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Bromo_Brdt_I_like 58..164 CDD:99929
Bromo_Brdt_II_like 355..456 CDD:99930 42/100 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..617 29/155 (19%)
NPS region. /evidence=ECO:0000250 486..505 8/18 (44%)
BID region. /evidence=ECO:0000250 526..581 6/55 (11%)
BET 611..675 CDD:407211 23/63 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 676..1126 94/330 (28%)
PHA03247 <793..1231 CDD:223021
C-terminal (CTD) region. /evidence=ECO:0000250 1051..1401
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1156..1378
TPH <1267..1308 CDD:404709
BRD4_CDT 1359..1401 CDD:407248
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X197
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.