DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and crebbpa

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_005161826.1 Gene:crebbpa / 566841 ZFINID:ZDB-GENE-050208-439 Length:2350 Species:Danio rerio


Alignment Length:299 Identity:68/299 - (22%)
Similarity:114/299 - (38%) Gaps:78/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TERSSPEINACKVI----IKRLFSSTYKNI------AWVFYEPLDPQLLGLHDYHEIVREPMDLS 61
            |..|||..:..|:.    :::....|.:::      :..|.:|:||.|||:.||.:||:.|:|||
Zfish   965 TASSSPSQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPILLGIPDYFDIVKNPIDLS 1029

  Fly    62 TVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQL---YICS 123
            |::.:|:||.|.....:..|:.|:|.|.:||.......|....:|..:||:....|..   |.|.
Zfish  1030 TIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQGLGYCCG 1094

  Fly   124 SGSKVRAEEESSSDESDSSSPED------------------EVNGSEVSPSIMGAPPSCTPTTEC 170
            ...:...:......:...:.|.|                  |:.|..|:   :|..|:       
Zfish  1095 RKYEFSPQTLCCYGKQLCTIPRDGTYYSYQNRYHFCEKCFNEIQGDSVT---LGDDPA------- 1149

  Fly   171 TPTPDWTPPATLETSEQ----------QEPFTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGAE 225
                   .|.|:.:.:|          .|||.  |..|...|:.|      :.|:|:........
Zfish  1150 -------QPQTMISKDQFERKKNDTLDPEPFV--ECKDCGRKMHQ------ICVLHYEVIWPSGF 1199

  Fly   226 YCNKELEFDICKLKVHTKRGIRDYLASKGFTGKRVARTK 264
            .|      |.|     .|:..:....:| ||.||:..|:
Zfish  1200 IC------DNC-----LKKSAKSRKENK-FTAKRLQSTR 1226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 32/110 (29%)
crebbpaXP_005161826.1 zf-TAZ 325..392 CDD:280324
KIX 548..628 CDD:280354
PHA03193 <751..919 CDD:177555
Bromo_cbp_like 980..1087 CDD:99927 32/106 (30%)
RING_CBP-p300 1099..1171 CDD:276805 10/88 (11%)
PHD_CBP 1172..1206 CDD:277117 11/52 (21%)
HAT_KAT11 1235..1542 CDD:285432
ZZ_CBP 1598..1638 CDD:239077
ZnF_TAZ 1659..1737 CDD:214717
Med15 1902..>2333 CDD:255446
Creb_binding 1957..2043 CDD:286163
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.