DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and ep300b

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_009297682.1 Gene:ep300b / 565612 ZFINID:ZDB-GENE-080403-15 Length:2646 Species:Danio rerio


Alignment Length:283 Identity:67/283 - (23%)
Similarity:102/283 - (36%) Gaps:93/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FYEPLDPQLLGLH-----------DYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNT 89
            |.:|:||||||:.           ||.:||:.|:||||::.:|:||.|.....:..|:.|:|.|.
Zfish  1048 FRQPVDPQLLGIPVRIRTSNKTNLDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNA 1112

  Fly    90 YLYTNPDHLCYHMAKQLQIIFEEMYSQV----------------QLYICSSGSKVRAEEESSSDE 138
            :||.......|....:|..:||:....|                |...|..........:::...
Zfish  1113 WLYNRKTSRVYKYCSKLAEVFEQEIDPVMQELGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFS 1177

  Fly   139 SDSSSPE---------------DEVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQ 188
            ..:|||:               :|:.|..||   :|..|              |.|   :||..:
Zfish  1178 YQNSSPKYGLLADRYHFCEKCFNEIQGENVS---LGDDP--------------TQP---QTSINK 1222

  Fly   189 EPFTTEEDLDLHAKIQQLDGEVLLH------------VIHFIQRMEGAEYCNKELEFDICKLKVH 241
            :.|..:       |...||.|:||.            |:|..........|      |.|..|.:
Zfish  1223 DQFQRK-------KNDTLDPELLLECGDCGRKMHQICVLHNETIWPSGFIC------DGCLKKSN 1274

  Fly   242 TKRGIRDYLASKGFTGKRVARTK 264
            :.|....|.|      ||:.:||
Zfish  1275 STRKENKYAA------KRLPQTK 1291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 31/88 (35%)
ep300bXP_009297682.1 zf-TAZ 318..385 CDD:280324
KIX 534..614 CDD:280354
Bromo_cbp_like 1024..1142 CDD:99927 32/93 (34%)
RING_CBP-p300 1154..1236 CDD:276805 19/108 (18%)
PHD_SF 1237..1271 CDD:304600 7/39 (18%)
HAT_KAT11 1300..1607 CDD:285432
ZZ_CBP 1663..1703 CDD:239077
ZnF_TAZ 1724..1802 CDD:214717
Creb_binding <2164..2231 CDD:286163
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.