DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and pbrm1

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_009304062.1 Gene:pbrm1 / 565366 ZFINID:ZDB-GENE-080926-4 Length:1627 Species:Danio rerio


Alignment Length:251 Identity:59/251 - (23%)
Similarity:101/251 - (40%) Gaps:51/251 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFY 87
            ||.|..::.:         |..:...||:.|::||:||.::.||:....|.|....||||.|:..
Zfish   202 RLISELFQRL---------PSKMQYPDYYAIIKEPIDLKSIAHRIQMCYYKSVNHMAKDIDLLVK 257

  Fly    88 NTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLYI-------CSSGSKVRAEEESSSD-------- 137
            |...|..|....:..|..::.:|    :|.:|.:       ||  .::|....:..|        
Zfish   258 NAKTYNEPGSQVFKDANTIKKVF----AQKKLELEHSEPIKCS--IRIRNRRFAHGDRLSCITTA 316

  Fly   138 -ESDSSSPEDEV-NGS----EV---SPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQ---EP 190
             :..|.|.||.: .||    ||   :.||..:.....|..:.     :.....:..|:.|   ||
Zfish   317 LQYGSESEEDAILTGSVHYDEVESEAESIHSSMDVSNPIFQM-----YEAVRGVRNSQGQLLAEP 376

  Fly   191 -FTTEEDLDLHAKIQQLDGEVLLHVIHFIQRMEGAEYCN-KELEFDICKLKVHTKR 244
             |......|.....||:...|.|..|.  .:|:..||.: ::::.|:.::..:.||
Zfish   377 FFQLPSRKDYPDYFQQISHPVSLQQIR--SKMKNNEYESVEQIDTDLNRMFENAKR 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 25/90 (28%)
pbrm1XP_009304062.1 Bromo_polybromo_I 45..156 CDD:99954
Bromo_polybromo_II 183..284 CDD:99948 26/94 (28%)
Bromo_polybromo_III 352..453 CDD:99951 18/86 (21%)
Bromo_polybromo_IV 488..591 CDD:99949
Bromo_polybromo_V 626..730 CDD:99946
Bromo_polybromo_VI 745..850 CDD:99956
BAH_polybromo 923..1042 CDD:240068
BAH_polybromo 1120..1238 CDD:240068
HMG 1341..1408 CDD:197700
Forkhead_N 1415..1541 CDD:254796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.