DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and ep300a

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_009304968.1 Gene:ep300a / 559273 ZFINID:ZDB-GENE-080403-16 Length:2682 Species:Danio rerio


Alignment Length:272 Identity:66/272 - (24%)
Similarity:106/272 - (38%) Gaps:73/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCY 100
            |.:|:||.|||:.||.:||:.||||||::.:|:||.|.....:..||.|:|.|.:||.......|
Zfish  1080 FRQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY 1144

  Fly   101 HMAKQLQIIFEEMYSQV----------------QLYICSSGSKVRAEEESSSDESDSSSPE---- 145
            ....:|..:||:....|                |...|..........:::.....:|||:    
Zfish  1145 KYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPKYGLL 1209

  Fly   146 -----------DEVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPATLETSEQQEPFTTEEDLDL 199
                       :|:.|..||   :|..||...|.        |....:..|..::.|..:     
Zfish  1210 ADRYHFCEKCFNEIQGETVS---LGDDPSQPQTA--------TIFLNISRSINKDQFEKK----- 1258

  Fly   200 HAKIQQLDGEVLLHVIHFIQRMEGAEYCNKELEFDICKLKVHT------------KRGIRDYLAS 252
              |...||.|:      |::.|:    |.:::. .||.|...|            |:..:....:
Zfish  1259 --KNDTLDPEL------FVECMD----CGRKMH-QICVLHNETIWPSGFVCDGCLKKSNKTRKEN 1310

  Fly   253 KGFTGKRVARTK 264
            | :..||:.:||
Zfish  1311 K-YAAKRLPQTK 1321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 32/77 (42%)
ep300aXP_009304968.1 zf-TAZ 362..429 CDD:280324
Med15 439..>907 CDD:255446
KIX 571..649 CDD:280354
Bromo_cbp_like 1056..1163 CDD:99927 33/82 (40%)
RING_CBP-p300 1175..1266 CDD:276805 19/108 (18%)
PHD_p300 1267..1301 CDD:277116 7/44 (16%)
HAT_KAT11 1330..1637 CDD:285432
ZZ_CBP 1693..1733 CDD:239077
ZnF_TAZ 1754..1832 CDD:214717
Creb_binding 2141..2246 CDD:286163
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.