DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and PBRM1

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_016862214.1 Gene:PBRM1 / 55193 HGNCID:30064 Length:1734 Species:Homo sapiens


Alignment Length:135 Identity:33/135 - (24%)
Similarity:59/135 - (43%) Gaps:10/135 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFY 87
            ||.|..::.:         |..:...||:.|::||:||.|:..|:..|.|.|....||||.|:..
Human   232 RLISELFQKL---------PSKVQYPDYYAIIKEPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAK 287

  Fly    88 NTYLYTNPDHLCYHMAKQLQIIFEEMYSQVQLY-ICSSGSKVRAEEESSSDESDSSSPEDEVNGS 151
            |...|..|....:..|..::.||....::::.: :..|..::|.....::......|......|.
Human   288 NAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHEMAKSSLRMRTPSNLAAARLTGPSHSKGSLGE 352

  Fly   152 EVSPS 156
            |.:|:
Human   353 ERNPT 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 27/90 (30%)
PBRM1XP_016862214.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.