DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and Cecr2

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_008761473.1 Gene:Cecr2 / 500308 RGDID:1564182 Length:1465 Species:Rattus norvegicus


Alignment Length:263 Identity:57/263 - (21%)
Similarity:95/263 - (36%) Gaps:72/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FSSTYKNI--------AWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKD 81
            |::.||.:        :|.|.||:|...  ..:|::|::.|||:|::..:||.|.|.:..:|..|
  Rat   420 FTAMYKVLDVVKAHKDSWPFLEPVDESY--APNYYQIIKIPMDISSMEKKLNGGLYCTKEEFVND 482

  Fly    82 IRLIFYNTYLYTNPD-----------HLCYHMAKQLQIIFEEMYSQVQLYI-------------- 121
            ::.:|.|...| |.|           ..|:|.|.......|:..:..:.:|              
  Rat   483 MKTMFRNCRKY-NGDSSEYTKMSENLERCFHRAMTKHFPGEDGDTDEEFWIREDEKREKRRSRAG 546

  Fly   122 CSSGSKVRAEEESSSDESDSSSPEDE------------VNGSEVSPSIMGAPPSCTPTT------ 168
            .||||.|......:...|....|.:.            .:|.:.|.|.:..||....:.      
  Rat   547 RSSGSHVWTRSRDTEGSSRKQPPMENGGKSLPPARRAASSGDDQSSSSIQLPPEVGTSNGRGFFH 611

  Fly   169 --ECTPTPDWTPPATLETSEQQEPFTT--------EEDLDLH--AKIQQL-DGEVLLHVIHFIQR 220
              ..:..|...||.     .|..|..:        .:..:||  ::|.:: .||.|.|....||.
  Rat   612 PLHYSRVPSQAPPL-----NQMRPAASGTFGSLQGSDPTNLHGSSRIPEVPPGEPLQHPPFAIQA 671

  Fly   221 MEG 223
            ..|
  Rat   672 PVG 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 29/107 (27%)
Cecr2XP_008761473.1 WHIM3 244..284 CDD:292248
Bromo_gcn5_like 418..518 CDD:99941 28/100 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.