DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and pbrm1l

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_005168819.1 Gene:pbrm1l / 445141 ZFINID:ZDB-GENE-010501-3 Length:1657 Species:Danio rerio


Alignment Length:175 Identity:42/175 - (24%)
Similarity:76/175 - (43%) Gaps:30/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEM 113
            ||:|||.:|:|:..::.:|....|.....|:.|..|:..||..|...|...:..|.:|..:|  :
Zfish    82 DYYEIVSQPIDMMKIQQKLRAEEYQDVEQFSADFHLLINNTKAYYQADSAEHRAASKLLNVF--L 144

  Fly   114 YSQVQLYICSSGSKVRAEEESSSDESDSSSPEDEVNGS---EVSPSIMGAPPSCTPTT------- 168
            .::.:|.....|.:...:|||...|:.::|.|:|...|   .:...::.|..|||.::       
Zfish   145 SAKNELLQGGDGEEAEDDEESEDAENTNASMEEERPPSYLKAILEQLLEAIASCTDSSGRLVSEL 209

  Fly   169 -ECTPT----PDWTPPATLETSEQQEPFTTEEDLDLHAKIQQLDG 208
             :..|:    ||:..             ..:|.:||.|..|::.|
Zfish   210 FQKLPSKLHYPDYYA-------------VIKEPIDLRAVAQKIQG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 19/64 (30%)
pbrm1lXP_005168819.1 Bromo_polybromo_I 43..152 CDD:99954 20/71 (28%)
Bromo_polybromo_II 184..286 CDD:99948 13/71 (18%)
Bromo_polybromo_III 352..452 CDD:99951
Bromo_polybromo_IV 485..585 CDD:99949
Bromo_polybromo_V 624..723 CDD:99946
Bromo_polybromo_VI 746..853 CDD:99956
BAH_polybromo 933..1049 CDD:240068
BAH_polybromo 1123..1241 CDD:240068
HMG-box 1346..1408 CDD:238037
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.