Sequence 1: | NP_726307.1 | Gene: | tbrd-3 / 246604 | FlyBaseID: | FBgn0050417 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001369030.1 | Gene: | tbrd-1 / 42823 | FlyBaseID: | FBgn0039124 | Length: | 513 | Species: | Drosophila melanogaster |
Alignment Length: | 219 | Identity: | 56/219 - (25%) |
---|---|---|---|
Similarity: | 90/219 - (41%) | Gaps: | 48/219 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 IKRLFSSTYKN-IAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRL 84
Fly 85 IFYNTYLYTNPDHLCYHMAKQLQIIFE------EMYSQVQLYICSSGSKVRAEEESSSDESDSSS 143
Fly 144 PEDEVNGSE-----------------------------VSPSIMGAPPSCTPTTECTPTPDWTPP 179
Fly 180 ATL---------ETSEQQEPFTTE 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tbrd-3 | NP_726307.1 | Bromo_Brdt_II_like | 13..114 | CDD:99930 | 33/99 (33%) |
tbrd-1 | NP_001369030.1 | Bromodomain | 39..143 | CDD:413371 | 33/95 (35%) |
Bromodomain | 328..423 | CDD:413371 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45468247 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5076 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000322 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR22880 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.840 |