DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and tbrd-1

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001369030.1 Gene:tbrd-1 / 42823 FlyBaseID:FBgn0039124 Length:513 Species:Drosophila melanogaster


Alignment Length:219 Identity:56/219 - (25%)
Similarity:90/219 - (41%) Gaps:48/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IKRLFSSTYKN-IAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRL 84
            :|.:.:..::| .::.|..|:|...||:.|||.:|:.||||||:|.||:...|..|::..:|.:|
  Fly    47 LKSVLNCLWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKL 111

  Fly    85 IFYNTYLYTNPDHLCYHMAKQLQIIFE------EMYSQVQLYICSSGSKVRAEEESSSDESDSSS 143
            ||.|..||.......|...|.|...|.      ::.::|:|...|...|.:|.|......:..|:
  Fly   112 IFDNCLLYNLEGSPVYQAGKLLMEAFYMRMESIDLSTEVELKPKSEKRKRKATESLDQASTSFSA 176

  Fly   144 PEDEVNGSE-----------------------------VSPSIMGAPPSCTPTTECTPTPDWTPP 179
            |....|.|.                             |.||::   ||..|.:...|.....|.
  Fly   177 PRASNNYSRQWLSSSSSWLCPPPMPGGVSSFNPSFRNFVGPSLI---PSFMPDSLVNPMQSMHPM 238

  Fly   180 ATL---------ETSEQQEPFTTE 194
            :::         ||:|..:|..:|
  Fly   239 SSMMNPIFKNNWETNEAMDPPPSE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 33/99 (33%)
tbrd-1NP_001369030.1 Bromodomain 39..143 CDD:413371 33/95 (35%)
Bromodomain 328..423 CDD:413371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468247
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22880
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.