DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and dikar

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001261480.1 Gene:dikar / 38747 FlyBaseID:FBgn0261934 Length:3261 Species:Drosophila melanogaster


Alignment Length:251 Identity:56/251 - (22%)
Similarity:96/251 - (38%) Gaps:70/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETERSSPEINACKVIIKRLFSSTYKNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTG 70
            |||... :|...||::   :...::: ||.|.:|::..:  ...|:.|:|.||||..:..:|::|
  Fly   887 ETEEVL-QIGMHKVLV---YVKNHRD-AWPFVDPVEEDI--APRYYSIIRRPMDLLKMEDKLDSG 944

  Fly    71 CYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV------------QLYICS 123
            .|...::|..|.|||..|..||...::....|...||..||:...:.            .|...:
  Fly   945 EYHKFSEFRNDFRLIVNNCRLYNGHNNEYTEMVNNLQDAFEKATKKYFDNLSDDEDDDPNLSYPA 1009

  Fly   124 SGSKV----------RAEEESSSDESDS---SSPEDEVNGSEVSPSIMGAPPSCTP--------- 166
            :.||:          :|:||:..|....   ||.|::::..|..     ||.....         
  Fly  1010 ADSKMNVFREKYFSKKAKEETEKDAPGRPAVSSAEEDLSEIEAE-----APQKAQKRKRKEKDKR 1069

  Fly   167 ------------------TTECTPTPDWTPPATLET------SEQQEPFTTEEDLD 198
                              ..|..|||...||.:.::      .|:::....|:|.|
  Fly  1070 RKKKTKSKADVETDDEDMEAEREPTPPPPPPTSKKSKTSKTGKEKEKDKEKEKDKD 1125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 30/100 (30%)
dikarNP_001261480.1 WHIM1 100..148 CDD:292246
Bromo_gcn5_like 892..991 CDD:99941 30/105 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.