DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tbrd-3 and tbrd-2

DIOPT Version :9

Sequence 1:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_611401.2 Gene:tbrd-2 / 37207 FlyBaseID:FBgn0034423 Length:674 Species:Drosophila melanogaster


Alignment Length:418 Identity:63/418 - (15%)
Similarity:117/418 - (27%) Gaps:209/418 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KNIAWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDIRLIFYNTYLY-- 92
            |..|..|.||:|.:.|.:..|:.::..|||:.|:..|:....|.|..:...|.:.|..|.:|:  
  Fly    49 KKYALDFLEPVDTEALMVPTYYTVIHRPMDIGTIVKRVQNNYYKSVNEAIADFKQIISNCFLFNR 113

  Fly    93 ------------------------------------------TN------PDHLCYHMAKQLQ-- 107
                                                      ||      .:..|..:.|:||  
  Fly   114 SGDVVYRKGQMLEKFFHKKLRGMPSGPEVPCNRDPKAVGRPRTNAPSSAQTERKCRELLKKLQSI 178

  Fly   108 --------------------------------------------------IIFEEMYSQVQLYIC 122
                                                              |::|.:::|...: |
  Fly   179 TNQTDAMTRNFFSNKWDSLQKKVDRQYFKSVNEFCLHVDGCFRKYHEPAKILYERVFNQPAAW-C 242

  Fly   123 SSGSKVRAEEESSSDESDSSSPEDEVNGSEVSPSIMGAPPSCTPTTECTPTPDWTPPAT----LE 183
            :|             .:.:||.|..:|.::::..:..|..:.....:|...|....|.|    :|
  Fly   243 TS-------------MNGNSSLESALNAADLNELLAAAKLTVNSLMQCVQMPGSGEPLTAKSLVE 294

  Fly   184 T-----------------------SEQQEPFTTEEDLDL---------------------HAKIQ 204
            |                       |.:::..:.|::.||                     ...|:
  Fly   295 TFCDTLNKMINKMEAGQRNSPNPSSSKRQKMSPEQETDLVQGEFKPAMELLSGNEIDNLMAVSIE 359

  Fly   205 QLDGE--------------------------VLLHVIHFIQRMEG--AEYCNKELEFDICKL--- 238
            ..|.|                          .:..:||.:|::||  :|.|. :|.||:..|   
  Fly   360 SSDDEAIDASMRITDADRCATQKLFAKLPTNAMKEIIHMVQQIEGFSSENCG-DLSFDVKGLATD 423

  Fly   239 -------------KVHTKRGIRDYLASK 253
                         :.|:|..::|...|:
  Fly   424 TMIMMKSAVTKATRAHSKLKLKDMQPSE 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 27/185 (15%)
tbrd-2NP_611401.2 Bromo_gcn5_like 34..136 CDD:99941 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.